Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rel Peptide - C-terminal region

Rel Peptide - C-terminal region

Product Specifications

UniProt

P15307

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with REL Rabbit Polyclonal Antibody (orb329897) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSCVDNGLMNEPGLSDDANNPTFVQSSHYSVNTLQSEQLSDPFTYGFFKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPRG1L Recombinant Protein (Human)
RP102581 100 µg

TPRG1L Recombinant Protein (Human)

Sign In for Pricing
View Details
Finerenone Nitroso Impurity 185 discontinued
RM-F260185-01 10 mg

Finerenone Nitroso Impurity 185 discontinued

Sign In for Pricing
View Details
Finerenone Nitroso Impurity 185 discontinued
RM-F260185-02 25 mg

Finerenone Nitroso Impurity 185 discontinued

Sign In for Pricing
View Details
Finerenone Nitroso Impurity 185 discontinued
RM-F260185-03 50 mg

Finerenone Nitroso Impurity 185 discontinued

Sign In for Pricing
View Details
Finerenone Nitroso Impurity 185 discontinued
RM-F260185-04 100 mg

Finerenone Nitroso Impurity 185 discontinued

Sign In for Pricing
View Details
Recombinant rat Erythropoietin/EPO protein
ATGP4000-050 50 µg

Recombinant rat Erythropoietin/EPO protein

Sign In for Pricing
View Details