Ptges2 Peptide - N-terminal region
Ptges2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
0610038H10Rik, C79137, Gbf1, Mpges2, Pges2
UniProt
Q8BWM0
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ptges2 Rabbit Polyclonal Antibody (orb329923) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_598544
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RLLGAAALALGGALGLYHTVRWHQRSQDLRAERSAAQLPLSNSLQLTLYQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB0940-500 1x 500 µL
Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), 0.2mg/mL
Sign In for Pricing
View Details 
