Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ptges2 Peptide - N-terminal region

Ptges2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

0610038H10Rik, C79137, Gbf1, Mpges2, Pges2

UniProt

Q8BWM0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ptges2 Rabbit Polyclonal Antibody (orb329923) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598544

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLLGAAALALGGALGLYHTVRWHQRSQDLRAERSAAQLPLSNSLQLTLYQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNS (NM_002076) Human Over-expression Lysate
LY419554 100 µg

GNS (NM_002076) Human Over-expression Lysate

Sign In for Pricing
View Details
HKR1 Antibody
8C10329-AAT 50 µg

HKR1 Antibody

Sign In for Pricing
View Details
4930453N24Rik Mouse Gene Knockout Kit (CRISPR)
KN500372 1 Kit

4930453N24Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Beta Amyloid (phospho T743) Antibody
RC-5556-01 50 μL

Recombinant Beta Amyloid (phospho T743) Antibody

Sign In for Pricing
View Details
Recombinant Beta Amyloid (phospho T743) Antibody
RC-5556-02 100 µL

Recombinant Beta Amyloid (phospho T743) Antibody

Sign In for Pricing
View Details
Recombinant Beta Amyloid (phospho T743) Antibody
RC-5556-03 1 mL

Recombinant Beta Amyloid (phospho T743) Antibody

Sign In for Pricing
View Details