Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEFTY2 Peptide - N-terminal region

LEFTY2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EBAF, LEFTA, LEFTYA, TGFB4

UniProt

O00292

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LEFTY2 Rabbit Polyclonal Antibody (orb330222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003231

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASB2, NT (ASB2, Ankyrin repeat and SOCS box protein 2) (MaxLight 490)
MBS6275540-01 0.1 mL

ASB2, NT (ASB2, Ankyrin repeat and SOCS box protein 2) (MaxLight 490)

Sign In for Pricing
View Details
ASB2, NT (ASB2, Ankyrin repeat and SOCS box protein 2) (MaxLight 490)
MBS6275540-02 5x 0.1 mL

ASB2, NT (ASB2, Ankyrin repeat and SOCS box protein 2) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit Polyclonal NANOS1 Antibody [PerCP]
NBP2-98706PCP 0.1 mL

Rabbit Polyclonal NANOS1 Antibody [PerCP]

Sign In for Pricing
View Details
Z-Sar-OH
4001068.01 100 g

Z-Sar-OH

Sign In for Pricing
View Details
SMPD1 (Sphingomyelin Phosphodiesterase (EC:3.1.4.12), Acid Sphingomyelinase, aSMase, ASM) discontinued
361208-01 50 µL

SMPD1 (Sphingomyelin Phosphodiesterase (EC:3.1.4.12), Acid Sphingomyelinase, aSMase, ASM) discontinued

Sign In for Pricing
View Details
SMPD1 (Sphingomyelin Phosphodiesterase (EC:3.1.4.12), Acid Sphingomyelinase, aSMase, ASM) discontinued
361208-02 100 µL

SMPD1 (Sphingomyelin Phosphodiesterase (EC:3.1.4.12), Acid Sphingomyelinase, aSMase, ASM) discontinued

Sign In for Pricing
View Details