Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEFTY2 Peptide - N-terminal region

LEFTY2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EBAF, LEFTA, LEFTYA, TGFB4

UniProt

O00292

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LEFTY2 Rabbit Polyclonal Antibody (orb330222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003231

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human COMT protein
COM0905-020 20 µg

Recombinant human COMT protein

Sign In for Pricing
View Details
CNTF ELISA Kit (Human)
OKEH02695-96W 96 Well

CNTF ELISA Kit (Human)

Sign In for Pricing
View Details
Prmt3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3118808 1.0 µg DNA

Prmt3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Recombinant Human HHIP Protein, C-His (Active)
AHN57501 100 μg

Recombinant Human HHIP Protein, C-His (Active)

Sign In for Pricing
View Details
CGB/HCG-Beta Rabbit Polyclonal Antibody
E10G35078 100 µL

CGB/HCG-Beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sprtn Mouse shRNA Lentiviral Particle (Locus ID 244666)
TL518670V 500 µL Each

Sprtn Mouse shRNA Lentiviral Particle (Locus ID 244666)

Sign In for Pricing
View Details