Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rara Peptide - N-terminal region

Rara Peptide - N-terminal region

Product Specifications

UniProt

Q4FK21

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RARA Rabbit Polyclonal Antibody (orb330263) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7420426K07Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3169205 3x 1.0 µg

7420426K07Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Marinobufagenin
MBS5760631 Inquire

Marinobufagenin

Sign In for Pricing
View Details
APH1A Antibody
R34323-100UG 100 µg

APH1A Antibody

Sign In for Pricing
View Details
TSC22D1 Protein Vector (Rat) (pPB-C-His)
PV313242 500 ng

TSC22D1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Small proline-rich protein 2B (SPRR2B) ELISA Kit
abx547097 96 Tests

Mouse Small proline-rich protein 2B (SPRR2B) ELISA Kit

Sign In for Pricing
View Details
Ino80b sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3105202 1.0 µg DNA

Ino80b sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details