NR2F1 Peptide - N-terminal region
NR2F1 Peptide - N-terminal region
Product Specifications
UniProt
F1DAL7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NR2F1 Rabbit Polyclonal Antibody (orb578617) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-EL-R0367-01 24 Tests
Rat NOS3/eNOS (Nitric Oxide Synthase 3, Endothelial) ELISA Kit
Sign In for Pricing
View Details E-EL-R0367-02 48 Tests
Rat NOS3/eNOS (Nitric Oxide Synthase 3, Endothelial) ELISA Kit
Sign In for Pricing
View Details E-EL-R0367-03 96 Tests
Rat NOS3/eNOS (Nitric Oxide Synthase 3, Endothelial) ELISA Kit
Sign In for Pricing
View Details 
LC431796 20 µg
Prolactin (PRL) (NM_001163558) Human Over-expression Lysate
Sign In for Pricing
View Details 
