Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAP130 Peptide - C-terminal region

SAP130 Peptide - C-terminal region

Product Specifications

UniProt

Q9H0E3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAP130 Rabbit Polyclonal Antibody (orb582218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ANNLSMPTSDLPPGASPRKKPRKQQHVISTEEGDMMETNSTDDEKSTAKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL 17F Human, HEK
OM296686-01 10 µg

IL 17F Human, HEK

Sign In for Pricing
View Details
IL 17F Human, HEK
OM296686-02 2 µg

IL 17F Human, HEK

Sign In for Pricing
View Details
IL 17F Human, HEK
OM296686-03 1 mg

IL 17F Human, HEK

Sign In for Pricing
View Details
Purified Anti-Human CD19 Antibody[CB19]
E-AB-F10040P-01 25 µg

Purified Anti-Human CD19 Antibody[CB19]

Sign In for Pricing
View Details
Purified Anti-Human CD19 Antibody[CB19]
E-AB-F10040P-02 100 µg

Purified Anti-Human CD19 Antibody[CB19]

Sign In for Pricing
View Details
Hematoporphyrin (Technical Grade, ~30%)
TRC-H245678-500MG 500 mg

Hematoporphyrin (Technical Grade, ~30%)

Sign In for Pricing
View Details