SAP130 Peptide - C-terminal region
SAP130 Peptide - C-terminal region
Product Specifications
UniProt
Q9H0E3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SAP130 Rabbit Polyclonal Antibody (orb582218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ANNLSMPTSDLPPGASPRKKPRKQQHVISTEEGDMMETNSTDDEKSTAKS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSM041403-01 10 µg
Recombinant Mouse IL-1 Receptor-Like 2/IL-1RL2/IL-1Rrp2/IL-36R (C-6His)
Sign In for Pricing
View Details PKSM041403-02 50 µg
Recombinant Mouse IL-1 Receptor-Like 2/IL-1RL2/IL-1Rrp2/IL-36R (C-6His)
Sign In for Pricing
View Details 
BNC402715-500 1x 500 µL
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2715), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741130-100 1x 100 µL
MUC18 / Mucin 18 / CD146 (MUC18/1130), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Phospho-GSK3 beta (S9) Recombinant Rabbit Monoclonal Antibody [SY02-71]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82cf6/imageurl/et1607-60.webp)
ET1607-60 100 µL
Phospho-GSK3 beta (S9) Recombinant Rabbit Monoclonal Antibody [SY02-71]
Sign In for Pricing
View Details