Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TESC Peptide - C-terminal region

TESC Peptide - C-terminal region

Product Specifications

Product Name Alternative

CHP3, TSC

UniProt

Q96BS2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TESC Rabbit Polyclonal Antibody (orb583429) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060369

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elovl1 (BC096673) Mouse Tagged ORF Clone
MG202071 10 µg

Elovl1 (BC096673) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF568 conjugate, 0.1mg/mL
BNC682561-500 1x 500 µL

NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SNRNP40 activation kit by CRISPRa
GA106280 1 Kit

Human SNRNP40 activation kit by CRISPRa

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/3802), CF568 conjugate, 0.1mg/mL
BNC683802-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/3802), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Citral
TRC-C520000-5G 5 g

Citral

Sign In for Pricing
View Details
Recombinant CTCF Antibody
RC-15543-01 50 μL

Recombinant CTCF Antibody

Sign In for Pricing
View Details