TESC Peptide - C-terminal region
TESC Peptide - C-terminal region
Product Specifications
Product Name Alternative
CHP3, TSC
UniProt
Q96BS2
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TESC Rabbit Polyclonal Antibody (orb583429) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060369
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQME
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP13825PU-N 400 µL
PIP5K3 (PIKFYVE) (Center) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC683076-500 1x 500 µL
APC / Adenomatous Polyposis Coli / FAP (Tumor Suppressor) (ALi 12-28), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Elab Fluor® 647 Anti-Mouse CD161/NK1.1 Antibody[PK136]](https://cdn.genprice.uk/products/763/68dd149b061270361e7cf0aa/imageurl/e-ab-f0987um.webp)
E-AB-F0987UM-01 25 µg
Elab Fluor® 647 Anti-Mouse CD161/NK1.1 Antibody[PK136]
Sign In for Pricing
View Details E-AB-F0987UM-02 100 µg
Elab Fluor® 647 Anti-Mouse CD161/NK1.1 Antibody[PK136]
Sign In for Pricing
View Details 
PKSM040924 100 µg
Recombinant Mouse ALCAM/CD166 Protein (His & Fc Tag)
Sign In for Pricing
View Details 