Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Polr2c Peptide - C-terminal region

Polr2c Peptide - C-terminal region

Product Specifications

UniProt

Q3UUX3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POLR2C Rabbit Polyclonal Antibody (orb583668) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERLGDLGPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Butyrate-d7
TRC-S615179-10MG 10 mg

Sodium Butyrate-d7

Sign In for Pricing
View Details
Catalase (CAT) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B8]
TA502564BM 100 µL

Catalase (CAT) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B8]

Sign In for Pricing
View Details
Mouse Fli1 activation kit by CRISPRa
GA201443 1 Kit

Mouse Fli1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS706051 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
REIIBP/NSD2 Recombinant Rabbit Monoclonal Antibody [PSH02-39]
HA721816 100 µL

REIIBP/NSD2 Recombinant Rabbit Monoclonal Antibody [PSH02-39]

Sign In for Pricing
View Details
PNLIPRP3 (NM_001011709) Human Over-expression Lysate
LY423298 100 µg

PNLIPRP3 (NM_001011709) Human Over-expression Lysate

Sign In for Pricing
View Details