Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Polr2c Peptide - C-terminal region

Polr2c Peptide - C-terminal region

Product Specifications

UniProt

Q3UUX3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POLR2C Rabbit Polyclonal Antibody (orb583668) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERLGDLGPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRISP2 (NM_001142417) Human Over-expression Lysate
LC428079 20 µg

CRISP2 (NM_001142417) Human Over-expression Lysate

Sign In for Pricing
View Details
KDM6A (NM_021140) Human Recombinant Protein
TP310861M 100 µg

KDM6A (NM_021140) Human Recombinant Protein

Sign In for Pricing
View Details
Acetyl L-Carnitine Hydrochloride
TRC-A171990-2.5G 2.5 g

Acetyl L-Carnitine Hydrochloride

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS507118 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Carboxy Polystyrene
H40045008.100G 100 g

Carboxy Polystyrene

Sign In for Pricing
View Details
2-Chloro-4’-hydroxybenzophenone
TRC-C366690-250MG 250 mg

2-Chloro-4’-hydroxybenzophenone

Sign In for Pricing
View Details