Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP10 Peptide - C-terminal region

CASP10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALPS2, FLICE2, MCH4

UniProt

Q92851

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASP10 Rabbit Polyclonal Antibody (orb584192) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116759

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSLCNHLKKLVPRHEDILSILTAVNDDVSRRVDKQGTKKQMPQPAFTLRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDLBP Polyclonal Antibody
MBS9126256-01 0.02 mL

HDLBP Polyclonal Antibody

Sign In for Pricing
View Details
HDLBP Polyclonal Antibody
MBS9126256-02 0.1 mL

HDLBP Polyclonal Antibody

Sign In for Pricing
View Details
HDLBP Polyclonal Antibody
MBS9126256-03 5x 0.1 mL

HDLBP Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal SUSD2 Antibody (1279C) [Alexa Fluor 488]
MAB90565AF488 100 µL

Rabbit Monoclonal SUSD2 Antibody (1279C) [Alexa Fluor 488]

Sign In for Pricing
View Details
CK2 beta (pS209) Antibody
E38PA1285 100 µL

CK2 beta (pS209) Antibody

Sign In for Pricing
View Details
4932438H23Rik (NM_028905) Mouse Tagged ORF Clone Lentiviral Particle
MR213912L3V 200 µL

4932438H23Rik (NM_028905) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details