Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1R Peptide - middle region

C1R Peptide - middle region

Product Specifications

UniProt

D3DUT5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C1R Rabbit Polyclonal Antibody (orb584561) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFRP2 Antibody (ATTO 700)
abx449694 100 µg

SFRP2 Antibody (ATTO 700)

Sign In for Pricing
View Details
HCLDN3 full length protein-synthetic nanodisc
orb2708034-01 10 µg

HCLDN3 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
HCLDN3 full length protein-synthetic nanodisc
orb2708034-02 50 µg

HCLDN3 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Arsa 3'UTR Lenti-reporter-Luc Vector
12459086 1.0 µg

Arsa 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse NUDC siRNA
abx926557-01 15 nmol

Mouse NUDC siRNA

Sign In for Pricing
View Details
Mouse NUDC siRNA
abx926557-02 30 nmol

Mouse NUDC siRNA

Sign In for Pricing
View Details