Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRE3 Peptide - C-terminal region

ADGRE3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EMR3

UniProt

E7EW83

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADGRE3 Rabbit Polyclonal Antibody (orb55711) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001276088.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQQVQKQYQKWFREIVKSKSESETYTLSSKMGPDSKPSEGDVFPGQVKRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kininogen-1 Antibody
KC-739-01 50 μL

Kininogen-1 Antibody

Sign In for Pricing
View Details
Kininogen-1 Antibody
KC-739-02 100 µL

Kininogen-1 Antibody

Sign In for Pricing
View Details
Kininogen-1 Antibody
KC-739-03 1 mL

Kininogen-1 Antibody

Sign In for Pricing
View Details
(3b,5a)-Cholesta-8,14-dien-3-ol
TRC-C431525-500MG 500 mg

(3b,5a)-Cholesta-8,14-dien-3-ol

Sign In for Pricing
View Details
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker), CF594 conjugate, 0.1mg/mL
BNC941645-100 1x 100 µL

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Adnexa: right
CS800216 5x 5 µm

Tissue FFPE Sections, Adnexa: right

Sign In for Pricing
View Details