Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRE3 Peptide - C-terminal region

ADGRE3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EMR3

UniProt

E7EW83

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADGRE3 Rabbit Polyclonal Antibody (orb55711) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001276088.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQQVQKQYQKWFREIVKSKSESETYTLSSKMGPDSKPSEGDVFPGQVKRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 (KRT18/1190), CF568 conjugate, 0.1mg/mL
BNC681190-500 1x 500 µL

Cytokeratin 18 (KRT18/1190), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Homocysteine (Hcy) Colorimetric Assay Kit
E-BC-K854-M-01 48 T (44 samples)

Homocysteine (Hcy) Colorimetric Assay Kit

Sign In for Pricing
View Details
Homocysteine (Hcy) Colorimetric Assay Kit
E-BC-K854-M-02 96 T (92 samples)

Homocysteine (Hcy) Colorimetric Assay Kit

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1014), CF640R conjugate, 0.1mg/mL
BNC400224-100 1x 100 µL

Major Vault Protein (MVP) (1014), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD31 Antibody[158-2B3]
E-AB-F1050M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD31 Antibody[158-2B3]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD31 Antibody[158-2B3]
E-AB-F1050M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD31 Antibody[158-2B3]

Sign In for Pricing
View Details