LHCGR Peptide - C-terminal region
LHCGR Peptide - C-terminal region
Product Specifications
UniProt
P22888
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LHCGR Rabbit Polyclonal Antibody (orb331116) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLLSKFGCCKRRAELYRRKDFSAYTSNCKNGFTGSNKPSQSTLKLSTLHC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Elab Fluor® 700 Rat IgG2a, κ Isotype Control[2A3]](https://cdn.genprice.uk/products/763/68dd149b061270361e7cefca/imageurl/e-ab-f09833m1.webp)
E-AB-F09833M1-01 25 µg
Elab Fluor® 700 Rat IgG2a, κ Isotype Control[2A3]
Sign In for Pricing
View Details E-AB-F09833M1-02 100 µg
Elab Fluor® 700 Rat IgG2a, κ Isotype Control[2A3]
Sign In for Pricing
View Details 
TRC-D194295-50MG 50 mg
Pentaerythritol Tris Ester With 3-(3,5-Di-tert-butyl-4-hydroxyphenyl)propionic Acid
Sign In for Pricing
View Details 