Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGAP1 Peptide - middle region

AGAP1 Peptide - middle region

Product Specifications

UniProt

Q9UPQ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AGAP1 Rabbit Polyclonal Antibody (orb585198) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQG

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICOSLG (Inducible T-Cell Co-Stimulator Ligand, B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, KIAA0653, LICOS) (HRP)
MBS6179636-01 0.1 mL

ICOSLG (Inducible T-Cell Co-Stimulator Ligand, B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, KIAA0653, LICOS) (HRP)

Sign In for Pricing
View Details
ICOSLG (Inducible T-Cell Co-Stimulator Ligand, B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, KIAA0653, LICOS) (HRP)
MBS6179636-02 5x 0.1 mL

ICOSLG (Inducible T-Cell Co-Stimulator Ligand, B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, KIAA0653, LICOS) (HRP)

Sign In for Pricing
View Details
MNAT1 Polyclonal Antibody
E55A05379 100 µg

MNAT1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Parathyroid Hormone (PTH)
MBS2139841-01 0.01 mg

Recombinant Parathyroid Hormone (PTH)

Sign In for Pricing
View Details
Recombinant Parathyroid Hormone (PTH)
MBS2139841-02 0.05 mg

Recombinant Parathyroid Hormone (PTH)

Sign In for Pricing
View Details
Recombinant Parathyroid Hormone (PTH)
MBS2139841-03 0.1 mg

Recombinant Parathyroid Hormone (PTH)

Sign In for Pricing
View Details