AGAP1 Peptide - middle region
AGAP1 Peptide - middle region
Product Specifications
UniProt
Q9UPQ3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AGAP1 Rabbit Polyclonal Antibody (orb585198) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQG
More Discoveries
Explore Other Products
Browse additional items from our catalog
K7223705 3x 1.0 µg
Nrp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details 
