Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC20B Peptide - N-terminal region

CDC20B Peptide - N-terminal region

Product Specifications

UniProt

Q86Y33

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC20B Rabbit Polyclonal Antibody (orb585421) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERTAPRRVRTEEEMLWESIMRVLSKDLKQKRSQDSANVLDSVNATYSDFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thrombospondin type-1 domain-containing protein 7B (THSD7B) Human ELISA Kit
H5905 96 Tests

Thrombospondin type-1 domain-containing protein 7B (THSD7B) Human ELISA Kit

Sign In for Pricing
View Details
Cdc42ep5 Rat shRNA Plasmid (Locus ID 361505)
TL707005 1 Kit

Cdc42ep5 Rat shRNA Plasmid (Locus ID 361505)

Sign In for Pricing
View Details
PRPSAP1 Double Nickase Plasmid (h2)
sc-407925-NIC-2 20 µg

PRPSAP1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Troponin Complex (I-C) Protein
abx069968 0.1 mg

Troponin Complex (I-C) Protein

Sign In for Pricing
View Details
UGT2B15 (UDP-glucuronosyltransferase 2B15, UDPGT 2B15, UDPGT2B15, HLUG4, UDP-glucuronosyltransferase 2B8, UDPGT 2B8, UGT2B8, UDPGTH3, UDPGTh-3) (APC)
135077-APC 100 µL

UGT2B15 (UDP-glucuronosyltransferase 2B15, UDPGT 2B15, UDPGT2B15, HLUG4, UDP-glucuronosyltransferase 2B8, UDPGT 2B8, UGT2B8, UDPGTH3, UDPGTh-3) (APC)

Sign In for Pricing
View Details
LGI3 Protein Vector (Mouse) (pPM-C-HA)
26481024 500 ng

LGI3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details