Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC20B Peptide - N-terminal region

CDC20B Peptide - N-terminal region

Product Specifications

UniProt

Q86Y33

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC20B Rabbit Polyclonal Antibody (orb585421) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERTAPRRVRTEEEMLWESIMRVLSKDLKQKRSQDSANVLDSVNATYSDFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Cytochrome o ubiquinol oxidase protein CyoD (cyoD)
orb2934358-01 20 µg

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Cytochrome o ubiquinol oxidase protein CyoD (cyoD)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Cytochrome o ubiquinol oxidase protein CyoD (cyoD)
orb2934358-02 100 µg

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Cytochrome o ubiquinol oxidase protein CyoD (cyoD)

Sign In for Pricing
View Details
Fluor568-conjugated Polyclonal Rabbit Anti-Human IgG (H+L) Secondary Antibody
APS0681-01 200 µL

Fluor568-conjugated Polyclonal Rabbit Anti-Human IgG (H+L) Secondary Antibody

Sign In for Pricing
View Details
Fluor568-conjugated Polyclonal Rabbit Anti-Human IgG (H+L) Secondary Antibody
APS0681-02 500 µL

Fluor568-conjugated Polyclonal Rabbit Anti-Human IgG (H+L) Secondary Antibody

Sign In for Pricing
View Details
Sparfloxacin
C16532-10mM/1mL 10 mM/1mL

Sparfloxacin

Sign In for Pricing
View Details
DLEU2L 3'UTR GFP Stable Cell Line
TU056053 1.0 mL

DLEU2L 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details