Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPDR1 Peptide - N-terminal region

EPDR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EPDR, UCC1, MERP1, MERP-1

UniProt

Q9UM22

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPDR1 Rabbit Polyclonal Antibody (orb326461) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001229875.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AIHWSLPRALVPATGTRASGSQKRQRPPKGQEALWSRPHSRHSAERAGGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Levulinic acid
C11705 25 µL

Levulinic acid

Sign In for Pricing
View Details
Cdh10 Mouse Gene Knockout Kit (CRISPR)
KN502999 1 Kit

Cdh10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NPTX2 Antibody
64-234 400 µL

NPTX2 Antibody

Sign In for Pricing
View Details
SMAD1 antibody
70R-50023 100 ul

SMAD1 antibody

Sign In for Pricing
View Details
Csk (E-3)
sc-166560 200 µg/mL

Csk (E-3)

Sign In for Pricing
View Details
WIF1 Polyclonal Antibody, PE-Cy7 Conjugated
bs-3917R-PE-Cy7 100 µL

WIF1 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details