Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPDR1 Peptide - N-terminal region

EPDR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EPDR, UCC1, MERP1, MERP-1

UniProt

Q9UM22

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPDR1 Rabbit Polyclonal Antibody (orb326461) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001229875.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AIHWSLPRALVPATGTRASGSQKRQRPPKGQEALWSRPHSRHSAERAGGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORD80 AAV siRNA Pooled Vector
44930161 1.0 µg

SNORD80 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
WTAP (NM_152858) Human Recombinant Protein
PH34070M5 20 µg

WTAP (NM_152858) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral mouse Sgcb shRNA (UAS) - Lentiviral mouse Sgcb shRNA (UAS) (25)
GTR15252389 1 Vial

Lentiviral mouse Sgcb shRNA (UAS) - Lentiviral mouse Sgcb shRNA (UAS) (25)

Sign In for Pricing
View Details
NUDT5 Conjugated Antibody
orb1616874 100 µL

NUDT5 Conjugated Antibody

Sign In for Pricing
View Details
Porcine GHRL ELISA Kit
orb1292697-01 48 Tests

Porcine GHRL ELISA Kit

Sign In for Pricing
View Details
Porcine GHRL ELISA Kit
orb1292697-02 96 Tests

Porcine GHRL ELISA Kit

Sign In for Pricing
View Details