Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200 Peptide - C-terminal region

CD200 Peptide - C-terminal region

Product Specifications

UniProt

F8W7G1

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD200 Rabbit Polyclonal Antibody (orb585648) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DiB
#60036 1x 10 mg

DiB

Sign In for Pricing
View Details
IL13 receptor alpha 1 (IL13RA1) (NM_001560) Human Over-expression Lysate
LY400598 100 µg

IL13 receptor alpha 1 (IL13RA1) (NM_001560) Human Over-expression Lysate

Sign In for Pricing
View Details
PerCP Anti-Human CD45 Antibody[HI30]
E-AB-F1137F-01 20 Tests

PerCP Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
PerCP Anti-Human CD45 Antibody[HI30]
E-AB-F1137F-02 100 Tests

PerCP Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
PerCP Anti-Human CD45 Antibody[HI30]
E-AB-F1137F-03 2x 100 Tests

PerCP Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
Desktop Multi frequency type Ultrasonic Cleaner BULC-201
BULC-201 Each

Desktop Multi frequency type Ultrasonic Cleaner BULC-201

Sign In for Pricing
View Details