CD200 Peptide - C-terminal region
CD200 Peptide - C-terminal region
Product Specifications
UniProt
F8W7G1
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD200 Rabbit Polyclonal Antibody (orb585648) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Thyroglobulin (TG) Mouse Monoclonal Antibody [Clone ID: SPM517]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd4b4/imageurl/am33262pu-s.webp)
AM33262PU-S 100 µg
Thyroglobulin (TG) Mouse Monoclonal Antibody [Clone ID: SPM517]
Sign In for Pricing
View Details 
