Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR6 Peptide - C-terminal region

GPR6 Peptide - C-terminal region

Product Specifications

UniProt

J3KQR3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR6 Rabbit Polyclonal Antibody (orb585939) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Secreted phospholipase A2 (sPLA2) ELISA Kit
NSL0229Ch 96 Tests

Chicken Secreted phospholipase A2 (sPLA2) ELISA Kit

Sign In for Pricing
View Details
Herpes Simplex Virus 2 (HSV 2) Gradient Purfied Antigen
ND-R0141 1 Each

Herpes Simplex Virus 2 (HSV 2) Gradient Purfied Antigen

Sign In for Pricing
View Details
CD115 (c-fms, Fms, CSF-1R, M-CSFR) (BSA & Azide Free) (Biotin) discontinued
C2447-50X-Biotin 100 µL

CD115 (c-fms, Fms, CSF-1R, M-CSFR) (BSA & Azide Free) (Biotin) discontinued

Sign In for Pricing
View Details
ZNF775 Rabbit Polyclonal Antibody (Cy7)
orb1079257 100 µL

ZNF775 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Recombinant Human Ceramide synthase 6 (CERS6), partial
MBS7088719-01 0.02 mg (E-Coli)

Recombinant Human Ceramide synthase 6 (CERS6), partial

Sign In for Pricing
View Details
Recombinant Human Ceramide synthase 6 (CERS6), partial
MBS7088719-02 0.1 mg (E-Coli)

Recombinant Human Ceramide synthase 6 (CERS6), partial

Sign In for Pricing
View Details