Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR6 Peptide - C-terminal region

GPR6 Peptide - C-terminal region

Product Specifications

UniProt

J3KQR3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR6 Rabbit Polyclonal Antibody (orb585939) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPG antibody
CAF50474 100 µg

MPG antibody

Sign In for Pricing
View Details
Latexin (LXN, Endogenous Carboxypeptidase Inhibitor, ECI, Protein MUM, Tissue Carboxypeptidase Inhibitor, TCI) discontinued
150605 100 µg

Latexin (LXN, Endogenous Carboxypeptidase Inhibitor, ECI, Protein MUM, Tissue Carboxypeptidase Inhibitor, TCI) discontinued

Sign In for Pricing
View Details
Anti-C5/C5a Antibody Picoband® Fluoro488 Conjugated
PA2308-1-Fluoro488 100 µg/Vial

Anti-C5/C5a Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
TRAIP Antibody
E51A14869 100 µL

TRAIP Antibody

Sign In for Pricing
View Details
Fv1 (BC052897) Mouse Tagged Lenti ORF Clone
MR207011L4 10 µg

Fv1 (BC052897) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
4-Benzoyl-1,3-thiazole
DFA97910-01 50 mg

4-Benzoyl-1,3-thiazole

Sign In for Pricing
View Details