Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR68 Peptide - C-terminal region

GPR68 Peptide - C-terminal region

Product Specifications

UniProt

A1A5B2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR68 Rabbit Polyclonal Antibody (orb585965) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GILRAVRRSHGTQKSRKDQIQRLVLSTVVIFLACFLPYHVLLLVRSVWEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atraid Mouse Gene Knockout Kit (CRISPR)
KN501844 1 Kit

Atraid Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MOBKL2A (MOB3A) Rabbit Polyclonal Antibody
TA360927 100 µL

MOBKL2A (MOB3A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant N-cadherin Antibody
RC-6363-01 50 μL

Recombinant N-cadherin Antibody

Sign In for Pricing
View Details
Recombinant N-cadherin Antibody
RC-6363-02 100 µL

Recombinant N-cadherin Antibody

Sign In for Pricing
View Details
Recombinant N-cadherin Antibody
RC-6363-03 1 mL

Recombinant N-cadherin Antibody

Sign In for Pricing
View Details
CDH3 Antibody
KC-15647-01 50 μL

CDH3 Antibody

Sign In for Pricing
View Details