GPR68 Peptide - C-terminal region
GPR68 Peptide - C-terminal region
Product Specifications
UniProt
A1A5B2
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GPR68 Rabbit Polyclonal Antibody (orb585965) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GILRAVRRSHGTQKSRKDQIQRLVLSTVVIFLACFLPYHVLLLVRSVWEA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PAX8 Recombinant Mouse Monoclonal Antibody [6G5-R]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea82130/imageurl/ha601270.webp)
