Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pola2 Peptide - middle region

Pola2 Peptide - middle region

Product Specifications

Product Name Alternative

AI573378

UniProt

Q8C2T6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pola2 Rabbit Polyclonal Antibody (orb586722) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157529

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSPSATPSQKYTSRTNRGEVVTTFGSAQGLSWSGRGGSGSVSLKVVGDPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KV125 rabbit pAb
E28PN4565 100 µL

KV125 rabbit pAb

Sign In for Pricing
View Details
ABCC10 Antibody
orb1246526 0.1 mg

ABCC10 Antibody

Sign In for Pricing
View Details
THI2.1 Recombinant Protein
OPCA03597-20UG 20 µg

THI2.1 Recombinant Protein

Sign In for Pricing
View Details
Free fatty Acids (FFA) Porcine ELISA Kit
D5114 96 Tests

Free fatty Acids (FFA) Porcine ELISA Kit

Sign In for Pricing
View Details
HNRNPDL Rabbit Polyclonal Antibody (HRP)
orb2082383 100 µL

HNRNPDL Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ANGPT1 Antibody
orb1330912 100 µg

ANGPT1 Antibody

Sign In for Pricing
View Details