Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pola2 Peptide - middle region

Pola2 Peptide - middle region

Product Specifications

Product Name Alternative

AI573378

UniProt

Q8C2T6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pola2 Rabbit Polyclonal Antibody (orb586722) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157529

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSPSATPSQKYTSRTNRGEVVTTFGSAQGLSWSGRGGSGSVSLKVVGDPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFluor™ Violet 540 Anti-human/ non-human primates/ mouse CD107a Antibody *H4A3*
11070120-AAT 100 Tests

MFluor™ Violet 540 Anti-human/ non-human primates/ mouse CD107a Antibody *H4A3*

Sign In for Pricing
View Details
Rat NRG2 (Neuregulin 2) ELISA Kit
MBS8805957-01 48 Well

Rat NRG2 (Neuregulin 2) ELISA Kit

Sign In for Pricing
View Details
Rat NRG2 (Neuregulin 2) ELISA Kit
MBS8805957-02 96 Well

Rat NRG2 (Neuregulin 2) ELISA Kit

Sign In for Pricing
View Details
Rat NRG2 (Neuregulin 2) ELISA Kit
MBS8805957-03 5x 96 Well

Rat NRG2 (Neuregulin 2) ELISA Kit

Sign In for Pricing
View Details
Rat NRG2 (Neuregulin 2) ELISA Kit
MBS8805957-04 10x 96 Well

Rat NRG2 (Neuregulin 2) ELISA Kit

Sign In for Pricing
View Details
5-Oxo-2-pyrrolidinepropanoic Acid
TRC-O859605-1G 1 g

5-Oxo-2-pyrrolidinepropanoic Acid

Sign In for Pricing
View Details