Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR10 Peptide - C-terminal region

MTMR10 Peptide - C-terminal region

Product Specifications

UniProt

Q9NXD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTMR10 Rabbit Polyclonal Antibody (orb586859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060232

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRRNSLILKPKPDPAQQTDSQNSDTEQYFREWFSKPANLHGVILPRVSGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Vibrio splendidus Arginine--tRNA ligase (argS), partial
MBS1195467 Inquire

Recombinant Vibrio splendidus Arginine--tRNA ligase (argS), partial

Sign In for Pricing
View Details
LHX2 antibody
10R-1254 100 ug

LHX2 antibody

Sign In for Pricing
View Details
Anti-SCN5A antibody
PAab07645 100 µg

Anti-SCN5A antibody

Sign In for Pricing
View Details
Recombinant Geobacillus thermodenitrificans Bifunctional protein pyrR (pyrR)
MBS1015346-01 0.02 mg (E-Coli)

Recombinant Geobacillus thermodenitrificans Bifunctional protein pyrR (pyrR)

Sign In for Pricing
View Details
Recombinant Geobacillus thermodenitrificans Bifunctional protein pyrR (pyrR)
MBS1015346-02 0.1 mg (E-Coli)

Recombinant Geobacillus thermodenitrificans Bifunctional protein pyrR (pyrR)

Sign In for Pricing
View Details
Recombinant Geobacillus thermodenitrificans Bifunctional protein pyrR (pyrR)
MBS1015346-03 0.02 mg (Yeast)

Recombinant Geobacillus thermodenitrificans Bifunctional protein pyrR (pyrR)

Sign In for Pricing
View Details