Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR10 Peptide - C-terminal region

MTMR10 Peptide - C-terminal region

Product Specifications

UniProt

Q9NXD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTMR10 Rabbit Polyclonal Antibody (orb586859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060232

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRRNSLILKPKPDPAQQTDSQNSDTEQYFREWFSKPANLHGVILPRVSGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS3AP6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV781946 1.0 µg DNA

RPS3AP6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Human SMYD2 Protein, N-His
bs-104030P-01 20 µg

Recombinant Human SMYD2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SMYD2 Protein, N-His
bs-104030P-02 50 µg

Recombinant Human SMYD2 Protein, N-His

Sign In for Pricing
View Details
PharmaScoop 316ss 2500ml
SAM1129 1 Each

PharmaScoop 316ss 2500ml

Sign In for Pricing
View Details
Rabbit Polyclonal Mammaglobin B Antibody [mFluor Violet 450 SE]
NBP2-97784MFV450 0.1 mL

Rabbit Polyclonal Mammaglobin B Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Rabbit Monoclonal ULBP-2 Antibody (003) [DyLight 755]
NBP2-90059IR 0.1 mL

Rabbit Monoclonal ULBP-2 Antibody (003) [DyLight 755]

Sign In for Pricing
View Details