PARPBP Peptide - C-terminal region
PARPBP Peptide - C-terminal region
Product Specifications
UniProt
Q9NWS1
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PARPBP Rabbit Polyclonal Antibody (orb586946) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YMENDLSEGVNPSVGRSTIGTSFGNVHLDRSKNEKVSRKSTSQTGNKSSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472673-500 1x 500 µL
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2673), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details