PARPBP Peptide - C-terminal region
PARPBP Peptide - C-terminal region
Product Specifications
UniProt
Q9NWS1
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PARPBP Rabbit Polyclonal Antibody (orb586946) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YMENDLSEGVNPSVGRSTIGTSFGNVHLDRSKNEKVSRKSTSQTGNKSSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB3337-500 1x 500 µL
CD11b / MAC-1 (Microglial Marker) (ITGAM/3337), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
T-5001-1 1 mg
Texas Red Conjugated Agaricus bisporus Lectin (Mushroom) -ABA-
Sign In for Pricing
View Details