Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGSF22 Peptide - N-terminal region

IGSF22 Peptide - N-terminal region

Product Specifications

UniProt

Q8N9C0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IGSF22 Rabbit Polyclonal Antibody (orb587459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NKEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cholecystokinin 8, Octapeptide (CCK8) ELISA Kit
RDR-CCK8-Mu-01 96 Tests

Mouse Cholecystokinin 8, Octapeptide (CCK8) ELISA Kit

Sign In for Pricing
View Details
Mouse Cholecystokinin 8, Octapeptide (CCK8) ELISA Kit
RDR-CCK8-Mu-02 48 Tests

Mouse Cholecystokinin 8, Octapeptide (CCK8) ELISA Kit

Sign In for Pricing
View Details
CD109 Human Gene Knockout Kit (CRISPR)
KN213359 1 Kit

CD109 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Pou2f3 activation kit by CRISPRa
GA203327 1 Kit

Mouse Pou2f3 activation kit by CRISPRa

Sign In for Pricing
View Details
C-12 NBD-dihydro-Ceramide
TRC-N381268-25MG 25 mg

C-12 NBD-dihydro-Ceramide

Sign In for Pricing
View Details
STAT1 Rabbit Polyclonal Antibody
AP20384PU-N 100 µg

STAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details