OR1N1 Peptide - C-terminal region
OR1N1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR1-26, OR1N3, OR9-22
UniProt
Q8NGS0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR1N1 Rabbit Polyclonal Antibody (orb587579) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036495
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PPSIASEEKDIAAAAMYTIVTPMLNPFIYSLRNKDMKGALKRLFSHRSIV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AGK-007-2 2 mL
Pure Goat Anti-Rabbit IgG Gel Specific Immobilized Antibodies
Sign In for Pricing
View Details 
GA100175 1 Kit
Human Alkaline Phosphatase (ALPPL2) activation kit by CRISPRa
Sign In for Pricing
View Details 
