Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1N1 Peptide - C-terminal region

OR1N1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR1-26, OR1N3, OR9-22

UniProt

Q8NGS0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1N1 Rabbit Polyclonal Antibody (orb587579) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036495

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPSIASEEKDIAAAAMYTIVTPMLNPFIYSLRNKDMKGALKRLFSHRSIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM22 Antibody
OC-1290-01 50 μL

ADAM22 Antibody

Sign In for Pricing
View Details
ADAM22 Antibody
OC-1290-02 100 µL

ADAM22 Antibody

Sign In for Pricing
View Details
ADAM22 Antibody
OC-1290-03 1 mL

ADAM22 Antibody

Sign In for Pricing
View Details
Anti-Bax Antibody [SZ3-07]
ET1603-34TR 20 µL

Anti-Bax Antibody [SZ3-07]

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS709896 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
WDR18 Rabbit Polyclonal Antibody
TA365148 100 µL

WDR18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details