OR2A7 Peptide - C-terminal region
OR2A7 Peptide - C-terminal region
Product Specifications
Product Name Alternative
HSDJ0798C17, OR2A21
UniProt
Q96R45
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR2A7 Rabbit Polyclonal Antibody (orb327043) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005328
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLICSLRNSEVKNTLKRVLGV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC473461-500 1x 500 µL
CD45RB (B-Cell Marker) (rPTPRC/1132), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-E702880-50MG 50 mg
(1S,3R,4R)-Ethyl 3-((tert-Butoxycarbonyl)amino)-4-(2-((5-chloropyridin-2-yl)amino)-2-oxoacetamido)cyclohexanecarboxylate
Sign In for Pricing
View Details 
