Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2A12 Peptide - C-terminal region

OR2A12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR2A12P, OR2A16P

UniProt

Q8NGT7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2A12 Rabbit Polyclonal Antibody (orb587580) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004135

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYMAPKSSHSQERRKILSLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C8orf44 (NM_019607) Human Over-expression Lysate
LY412733 100 µg

C8orf44 (NM_019607) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Meckelin (TMEM67) ELISA Kit
EK6354 48 Tests

Mouse Meckelin (TMEM67) ELISA Kit

Sign In for Pricing
View Details
Human Sirtuin 1 (SIRT1) ELISA Kit
MBS4502502-01 48 Tests

Human Sirtuin 1 (SIRT1) ELISA Kit

Sign In for Pricing
View Details
Human Sirtuin 1 (SIRT1) ELISA Kit
MBS4502502-02 96 Tests

Human Sirtuin 1 (SIRT1) ELISA Kit

Sign In for Pricing
View Details
Human Sirtuin 1 (SIRT1) ELISA Kit
MBS4502502-03 5x 96 Tests

Human Sirtuin 1 (SIRT1) ELISA Kit

Sign In for Pricing
View Details
Human Sirtuin 1 (SIRT1) ELISA Kit
MBS4502502-04 10x 96 Tests

Human Sirtuin 1 (SIRT1) ELISA Kit

Sign In for Pricing
View Details