Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2A12 Peptide - C-terminal region

OR2A12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR2A12P, OR2A16P

UniProt

Q8NGT7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2A12 Rabbit Polyclonal Antibody (orb587580) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004135

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYMAPKSSHSQERRKILSLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC anti-human CD227 (MUC-1)
E16FHA227-025 25 Tests

APC anti-human CD227 (MUC-1)

Sign In for Pricing
View Details
Traf2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4397402 1.0 µg DNA

Traf2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Lentiviral mouse Ints5 shRNA (UAS) - Lentiviral mouseInts5 shRNA (UAS, GFP) (25)
GTR15232940 1 Vial

Lentiviral mouse Ints5 shRNA (UAS) - Lentiviral mouseInts5 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rat Angiotensin II Receptor 1 (AT1R) ELISA Kit
orb2812506-01 48 Tests

Rat Angiotensin II Receptor 1 (AT1R) ELISA Kit

Sign In for Pricing
View Details
Rat Angiotensin II Receptor 1 (AT1R) ELISA Kit
orb2812506-02 96 Tests

Rat Angiotensin II Receptor 1 (AT1R) ELISA Kit

Sign In for Pricing
View Details
Rat Angiotensin II Receptor 1 (AT1R) ELISA Kit
orb2812506-03 5 x 96 T

Rat Angiotensin II Receptor 1 (AT1R) ELISA Kit

Sign In for Pricing
View Details