Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2A42 Peptide - C-terminal region

OR2A42 Peptide - C-terminal region

Product Specifications

UniProt

Q8NGT9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2A42 Rabbit Polyclonal Antibody (orb587581) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005287

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Osteoprotegerin Ligand (OPGL) ELISA Kit
QY-E03316 96 Tests

Human Osteoprotegerin Ligand (OPGL) ELISA Kit

Sign In for Pricing
View Details
USF1 (Upstream Transcription Factor 1, FCHL, FCHL1, HYPLIP1, MLTF, MLTFI, UEF, bHLHb11) (FITC)
MBS6175006-01 0.1 mL

USF1 (Upstream Transcription Factor 1, FCHL, FCHL1, HYPLIP1, MLTF, MLTFI, UEF, bHLHb11) (FITC)

Sign In for Pricing
View Details
USF1 (Upstream Transcription Factor 1, FCHL, FCHL1, HYPLIP1, MLTF, MLTFI, UEF, bHLHb11) (FITC)
MBS6175006-02 5x 0.1 mL

USF1 (Upstream Transcription Factor 1, FCHL, FCHL1, HYPLIP1, MLTF, MLTFI, UEF, bHLHb11) (FITC)

Sign In for Pricing
View Details
Sheep Histidine Ammonia-Lyase (HAL) ELISA Kit
MBS9360034-01 48 Well

Sheep Histidine Ammonia-Lyase (HAL) ELISA Kit

Sign In for Pricing
View Details
Sheep Histidine Ammonia-Lyase (HAL) ELISA Kit
MBS9360034-02 96 Well

Sheep Histidine Ammonia-Lyase (HAL) ELISA Kit

Sign In for Pricing
View Details
Sheep Histidine Ammonia-Lyase (HAL) ELISA Kit
MBS9360034-03 5x 96 Well

Sheep Histidine Ammonia-Lyase (HAL) ELISA Kit

Sign In for Pricing
View Details