Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2A42 Peptide - C-terminal region

OR2A42 Peptide - C-terminal region

Product Specifications

UniProt

Q8NGT9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2A42 Rabbit Polyclonal Antibody (orb587581) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005287

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-type Ca++ CP α1C (D-6) : m-IgG Fc BP-HRP Bundle
sc-530794 1 Kit

L-type Ca++ CP α1C (D-6) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Z-L-phenylalaninol 98+% (HPLC)
242821-01 5 g

Z-L-phenylalaninol 98+% (HPLC)

Sign In for Pricing
View Details
Z-L-phenylalaninol 98+% (HPLC)
242821-02 25 g

Z-L-phenylalaninol 98+% (HPLC)

Sign In for Pricing
View Details
Z-L-phenylalaninol 98+% (HPLC)
242821-03 100 g

Z-L-phenylalaninol 98+% (HPLC)

Sign In for Pricing
View Details
Mouse OVA sIgG ELISA Kit
EMO0340 96 Tests

Mouse OVA sIgG ELISA Kit

Sign In for Pricing
View Details
FAK (PTK2) pTyr925 Rabbit Polyclonal Antibody
AP20939PU-N 100 µg

FAK (PTK2) pTyr925 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details