Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2F2 Peptide - C-terminal region

OR2F2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR7-1

UniProt

O95006

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2F2 Rabbit Polyclonal Antibody (orb587583) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004685

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PHSGPSVLQEKLISVFYAIVMPLLNPVIYSLRNKEVKGAWHKLLEKFSGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDIT3, ID (DDIT3, CHOP, CHOP10, GADD153, DNA damage-inducible transcript 3 protein, C/EBP-homologous protein, C/EBP-homologous protein 10, Growth arrest and DNA damage-inducible protein GADD153)
034535 200 µL

DDIT3, ID (DDIT3, CHOP, CHOP10, GADD153, DNA damage-inducible transcript 3 protein, C/EBP-homologous protein, C/EBP-homologous protein 10, Growth arrest and DNA damage-inducible protein GADD153)

Sign In for Pricing
View Details
ABCC9 siRNA (Rat)
MBS8206794-01 15 nmol

ABCC9 siRNA (Rat)

Sign In for Pricing
View Details
ABCC9 siRNA (Rat)
MBS8206794-02 30 nmol

ABCC9 siRNA (Rat)

Sign In for Pricing
View Details
ABCC9 siRNA (Rat)
MBS8206794-03 5x 30 nmol

ABCC9 siRNA (Rat)

Sign In for Pricing
View Details
Mouse Monoclonal EMMPRIN/CD147 Antibody (MEM-M6/1) [DyLight 755]
NB500-430IR 0.1 mL

Mouse Monoclonal EMMPRIN/CD147 Antibody (MEM-M6/1) [DyLight 755]

Sign In for Pricing
View Details
L-Glutamic acid monosodium salt monohydrate
BUP19892-01 500 mg

L-Glutamic acid monosodium salt monohydrate

Sign In for Pricing
View Details