Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2F2 Peptide - C-terminal region

OR2F2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR7-1

UniProt

O95006

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2F2 Rabbit Polyclonal Antibody (orb587583) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004685

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PHSGPSVLQEKLISVFYAIVMPLLNPVIYSLRNKEVKGAWHKLLEKFSGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM116B siRNA Oligos set (Human)
19728171 3x 5 nmol

FAM116B siRNA Oligos set (Human)

Sign In for Pricing
View Details
Anti-CTPS CTPS1 Antibody
B2021791 100 µL

Anti-CTPS CTPS1 Antibody

Sign In for Pricing
View Details
Human KCNJ15 siRNA
abx902797-01 15 nmol

Human KCNJ15 siRNA

Sign In for Pricing
View Details
Human KCNJ15 siRNA
abx902797-02 30 nmol

Human KCNJ15 siRNA

Sign In for Pricing
View Details
Lentiviral human PHYKPL shRNA (UAS) - Lentiviral human PHYKPL shRNA (UAS, RFP) (25)
GTR15336206 1 Vial

Lentiviral human PHYKPL shRNA (UAS) - Lentiviral human PHYKPL shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Human coronavirus (HCoV-OC43) Hemagglutinin esterase Protein (His Tag)
PO55398M2 100 µg

Human coronavirus (HCoV-OC43) Hemagglutinin esterase Protein (His Tag)

Sign In for Pricing
View Details