Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2M4 Peptide - C-terminal region

OR2M4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSHTPCRX18, HTPCRX18, OR1-55, OST710, TPCR100

UniProt

Q96R27

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2M4 Rabbit Polyclonal Antibody (orb327047) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059974

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAFERLLVICCVVMLIFPVSVIILSYSHVLRAVIHMGSGESRRKAFTTCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpaca IgG2b+2c, AlpHcAbs® Rabbit antibody (Biotin)
HA710032 100 µg

Alpaca IgG2b+2c, AlpHcAbs® Rabbit antibody (Biotin)

Sign In for Pricing
View Details
Human IGFBP7, C-His Tag
HA211108-01 20 µg

Human IGFBP7, C-His Tag

Sign In for Pricing
View Details
Human IGFBP7, C-His Tag
HA211108-02 50 µg

Human IGFBP7, C-His Tag

Sign In for Pricing
View Details
Human IGFBP7, C-His Tag
HA211108-03 100 µg

Human IGFBP7, C-His Tag

Sign In for Pricing
View Details
Acetic Acid 3-Buten-1-yl Ester
TRC-A158600-500MG 500 mg

Acetic Acid 3-Buten-1-yl Ester

Sign In for Pricing
View Details
KGF (FGF7) (NM_002009) Human Recombinant Protein
TP324418L 1 mg

KGF (FGF7) (NM_002009) Human Recombinant Protein

Sign In for Pricing
View Details