Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2S2 Peptide - C-terminal region

OR2S2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR37A, OST715

UniProt

Q9NQN1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2S2 Rabbit Polyclonal Antibody (orb327048) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_063950

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKVFSTCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL10 antibody
10R-3426 100 ul

BCL10 antibody

Sign In for Pricing
View Details
Polyclonal Antibody to Secreted Frizzled Related Protein 1 (SFRP1)
MBS2006049-01 0.1 mL

Polyclonal Antibody to Secreted Frizzled Related Protein 1 (SFRP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Secreted Frizzled Related Protein 1 (SFRP1)
MBS2006049-02 0.2 mL

Polyclonal Antibody to Secreted Frizzled Related Protein 1 (SFRP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Secreted Frizzled Related Protein 1 (SFRP1)
MBS2006049-03 0.5 mL

Polyclonal Antibody to Secreted Frizzled Related Protein 1 (SFRP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Secreted Frizzled Related Protein 1 (SFRP1)
MBS2006049-04 1 mL

Polyclonal Antibody to Secreted Frizzled Related Protein 1 (SFRP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Secreted Frizzled Related Protein 1 (SFRP1)
MBS2006049-05 5 mL

Polyclonal Antibody to Secreted Frizzled Related Protein 1 (SFRP1)

Sign In for Pricing
View Details