Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2W3 Peptide - C-terminal region

OR2W3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR2W3P, OR2W8P, OST718

UniProt

Q7Z3T1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2W3 Rabbit Polyclonal Antibody (orb587587) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001957

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGALGRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trihexyl Phosphate (>90%)
TRC-T794765-500MG 500 mg

Trihexyl Phosphate (>90%)

Sign In for Pricing
View Details
Tissue FFPE Sections, Small intestine
CS809274 5x 5 µm

Tissue FFPE Sections, Small intestine

Sign In for Pricing
View Details
PPP4C Antibody
KC-6072-01 50 μL

PPP4C Antibody

Sign In for Pricing
View Details
PPP4C Antibody
KC-6072-02 100 µL

PPP4C Antibody

Sign In for Pricing
View Details
PPP4C Antibody
KC-6072-03 1 mL

PPP4C Antibody

Sign In for Pricing
View Details
TWF2 Polyclonal Antibody
E-AB-14683-01 20 µL

TWF2 Polyclonal Antibody

Sign In for Pricing
View Details