Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2W3 Peptide - C-terminal region

OR2W3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR2W3P, OR2W8P, OST718

UniProt

Q7Z3T1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2W3 Rabbit Polyclonal Antibody (orb587587) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001957

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGALGRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2'-Hydroxypropiophenone
TRC-H996363-5G 5 g

2'-Hydroxypropiophenone

Sign In for Pricing
View Details
HypoGel® 200 RAM
SP200110150230.25G 25 g

HypoGel® 200 RAM

Sign In for Pricing
View Details
Recombinant Human ADGRE5 Protein (His Tag)
PDMH100241-01 20 µg

Recombinant Human ADGRE5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ADGRE5 Protein (His Tag)
PDMH100241-02 100 µg

Recombinant Human ADGRE5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ADGRE5 Protein (His Tag)
PDMH100241-03 500 µg

Recombinant Human ADGRE5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ADGRE5 Protein (His Tag)
PDMH100241-04 1 mg

Recombinant Human ADGRE5 Protein (His Tag)

Sign In for Pricing
View Details